PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.28243s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 340aa    MW: 37839.7 Da    PI: 7.7517
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.28243s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.82.4e-16741135
                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                          C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Bostr.28243s0001.1.p  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                          ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.7E-11155IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.85E-12546No hitNo description
CDDcd002021.23E-17663No hitNo description
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.4E-13741IPR013088Zinc finger, NHR/GATA-type
PfamPF003203.9E-14741IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.5E-8236325IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLVNYTPLHS RAEGDEIEIE  60
DHRAQRVMIK GMSLNKKIPK RKLYQENFTV KRANLEFNTG FKRKALDEEA SNRSSSGSVV  120
SNSESCAQSN AWDTTFPCKR RTCVGRPKAA SSVEKLTKDL YTILQEQQSS SLSGSSEEDL  180
LFENETPMLI GHGSVLMRDP HSGAREEESE ASSLLVESSK SSSVHSAKLG GKAIKQEQLK  240
RSKSQVLGRH SLLLCSIDLK DVFNFDEFIE KFTEEEQQKL MKLLPQVDSV DGPDSLRSMF  300
ESSQFKENFS LFQQLVADGV FETSSSGSKL EDIKTLAKLA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17582KKIPKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0202590.0BT020259.1 Arabidopsis thaliana At5g47140 gene, complete cds.
GenBankBT0204500.0BT020450.1 Arabidopsis thaliana At5g47140 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010481361.10.0PREDICTED: GATA transcription factor 27-like isoform X1
SwissprotQ5PP380.0GAT27_ARATH; GATA transcription factor 27
TrEMBLD7MPX30.0D7MPX3_ARALL; Zinc finger family protein
STRINGfgenesh1_pg.C_scaffold_80000660.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.10.0GATA transcription factor 27